Lineage for d1ivhb1 (1ivh B:242-392)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2246Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies)
  4. 2357Superfamily a.24.6: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47203] (1 family) (S)
  5. 2358Family a.24.6.1: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47204] (3 proteins)
  6. 2363Protein Isovaleryl-CoA dehydrogenase [47210] (1 species)
  7. 2364Species Human (Homo sapiens) [TaxId:9606] [47211] (1 PDB entry)
  8. 2366Domain d1ivhb1: 1ivh B:242-392 [16609]
    Other proteins in same PDB: d1ivha2, d1ivhb2, d1ivhc2, d1ivhd2

Details for d1ivhb1

PDB Entry: 1ivh (more details), 2.6 Å

PDB Description: structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity

SCOP Domain Sequences for d1ivhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivhb1 a.24.6.1 (B:242-392) Isovaleryl-CoA dehydrogenase {Human (Homo sapiens)}
kgvyvlmsgldlerlvlaggplglmqavldhtipylhvreafgqkighfqlmqgkmadmy
trlmacrqyvynvakacdeghctakdcagvilysaecatqvaldgiqcfggngyindfpm
grflrdaklyeigagtsevrrlvigrafnad

SCOP Domain Coordinates for d1ivhb1:

Click to download the PDB-style file with coordinates for d1ivhb1.
(The format of our PDB-style files is described here.)

Timeline for d1ivhb1: