Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (15 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [187908] (3 PDB entries) |
Domain d2jd82_: 2jd8 2: [166085] automated match to d1vlga_ complexed with fe, so4, zn |
PDB Entry: 2jd8 (more details), 2.8 Å
SCOPe Domain Sequences for d2jd82_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jd82_ a.25.1.0 (2:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
Timeline for d2jd82_:
View in 3D Domains from other chains: (mouse over for more information) d2jd80_, d2jd81_, d2jd83_, d2jd84_, d2jd85_, d2jd86_, d2jd87_, d2jd88_, d2jd89_, d2jd8a_, d2jd8b_, d2jd8c_, d2jd8d_, d2jd8e_, d2jd8f_, d2jd8g_, d2jd8h_, d2jd8i_, d2jd8j_, d2jd8k_, d2jd8l_, d2jd8m_, d2jd8n_, d2jd8o_, d2jd8p_, d2jd8q_, d2jd8r_, d2jd8s_, d2jd8t_, d2jd8u_, d2jd8v_, d2jd8w_, d2jd8x_, d2jd8y_, d2jd8z_ |