SCOPe 2.06: Domain d2jd7i_: 2jd7 I:

Lineage for d2jd7i_ (2jd7 I:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [187908] (4 PDB entries)

8. Domain d2jd7i_: 2jd7 I: [166065]
   automated match to d1vlga_
   complexed with fe, so4

Details for d2jd7i_

PDB Entry: 2jd7, 2.8 Å

PDB Description: crystal structure of the fe-soaked ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus

PDB Compounds: (I:) ferritin homolog

SCOPe Domain Sequences for d2jd7i_:

Sequence; same for both SEQRES and ATOM records:

>d2jd7i_ a.25.1.0 (I:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg

Timeline for d2jd7i_:

• d2jd7i_ first appeared in SCOPe 2.01
  
• d2jd7i_ appears in SCOPe 2.05
  
• d2jd7i_ appears in SCOPe 2.07
  
• d2jd7i_ appears in the current release, SCOPe 2.08