Lineage for d1egea1 (1ege A:242-396)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97006Fold a.29: Bromodomain-like [47363] (4 superfamilies)
  4. 97021Superfamily a.29.3: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47203] (1 family) (S)
  5. 97022Family a.29.3.1: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47204] (3 proteins)
  6. 97036Protein Medium chain acyl-CoA dehydrogenase [47207] (2 species)
  7. 97037Species Human (Homo sapiens) [TaxId:9606] [47209] (3 PDB entries)
  8. 97046Domain d1egea1: 1ege A:242-396 [16604]
    Other proteins in same PDB: d1egea2, d1egeb2, d1egec2, d1eged2

Details for d1egea1

PDB Entry: 1ege (more details), 2.75 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase

SCOP Domain Sequences for d1egea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egea1 a.29.3.1 (A:242-396) Medium chain acyl-CoA dehydrogenase {Human (Homo sapiens)}
gagfkvamgafdktrpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyegtsqiqrlivarehidkykn

SCOP Domain Coordinates for d1egea1:

Click to download the PDB-style file with coordinates for d1egea1.
(The format of our PDB-style files is described here.)

Timeline for d1egea1: