SCOPe 2.05: Domain d1egcc1: 1egc C:242-396

Lineage for d1egcc1 (1egc C:242-396)

Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds)
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [47209] (5 PDB entries)
Uniprot P11310 34-421
Domain d1egcc1: 1egc C:242-396 [16602]
Other proteins in same PDB: d1egca2, d1egcb2, d1egcc2, d1egcd2
complexed with co8, fad; mutant

Details for d1egcc1

PDB Entry: 1egc (more details), 2.6 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase complexed with octanoyl-coa

PDB Compounds: (C:) medium chain acyl-coa dehydrogenase

SCOPe Domain Sequences for d1egcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egcc1 a.29.3.1 (C:242-396) Medium chain acyl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
gagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyggtsqiqrlivarehidkykn

SCOPe Domain Coordinates for d1egcc1:

Click to download the PDB-style file with coordinates for d1egcc1.
(The format of our PDB-style files is described here.)

Timeline for d1egcc1: