Lineage for d2jd60_ (2jd6 0:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1730127Species Pyrococcus furiosus [TaxId:2261] [187908] (4 PDB entries)
  8. 1730128Domain d2jd60_: 2jd6 0: [166011]
    automated match to d1vlga_
    complexed with fe, so4

Details for d2jd60_

PDB Entry: 2jd6 (more details), 2.75 Å

PDB Description: crystal structure of the as isolated ferritin from the hyperthermophilic archaeal anaerobe pyrococcus furiosus
PDB Compounds: (0:) ferritin homolog

SCOPe Domain Sequences for d2jd60_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jd60_ a.25.1.0 (0:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny
iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl
ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg

SCOPe Domain Coordinates for d2jd60_:

Click to download the PDB-style file with coordinates for d2jd60_.
(The format of our PDB-style files is described here.)

Timeline for d2jd60_: