Lineage for d1egca1 (1egc A:242-396)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46463Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies)
  4. 46594Superfamily a.24.6: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47203] (1 family) (S)
  5. 46595Family a.24.6.1: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47204] (3 proteins)
  6. 46606Protein Medium chain acyl-CoA dehydrogenase [47207] (2 species)
  7. 46607Species Human (Homo sapiens) [TaxId:9606] [47209] (3 PDB entries)
  8. 46612Domain d1egca1: 1egc A:242-396 [16600]
    Other proteins in same PDB: d1egca2, d1egcb2, d1egcc2, d1egcd2

Details for d1egca1

PDB Entry: 1egc (more details), 2.6 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase complexed with octanoyl-coa

SCOP Domain Sequences for d1egca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egca1 a.24.6.1 (A:242-396) Medium chain acyl-CoA dehydrogenase {Human (Homo sapiens)}
gagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyggtsqiqrlivarehidkykn

SCOP Domain Coordinates for d1egca1:

Click to download the PDB-style file with coordinates for d1egca1.
(The format of our PDB-style files is described here.)

Timeline for d1egca1: