SCOPe 2.04: Domain d2jbll_: 2jbl L:

Lineage for d2jbll_ (2jbl L:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (10 PDB entries)

8. Domain d2jbll_: 2jbl L: [165989]
   Other proteins in same PDB: d2jblc_, d2jblh1, d2jblh2, d2jblm_
   complexed with bcb, bpb, fe, hem, lda, mq7, ns5, sma, so4

Details for d2jbll_

PDB Entry: 2jbl, 2.4 Å

PDB Description: photosynthetic reaction center from blastochloris viridis

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2jbll_:

Sequence; same for both SEQRES and ATOM records:

>d2jbll_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d2jbll_:

• d2jbll_ first appeared in SCOPe 2.01
  
• d2jbll_ appears in SCOPe 2.03
  
• d2jbll_ appears in SCOPe 2.05
  
• d2jbll_ appears in the current release, SCOPe 2.08