SCOPe 2.05: Domain d2jblh2: 2jbl H:1-36

Lineage for d2jblh2 (2jbl H:1-36)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (15 PDB entries)
   synonym: blastochloris viridis

8. Domain d2jblh2: 2jbl H:1-36 [165988]
   Other proteins in same PDB: d2jblc_, d2jblh1, d2jbll_, d2jblm_
   complexed with bcb, bpb, fe, hem, lda, mq7, ns5, sma, so4

Details for d2jblh2

PDB Entry: 2jbl, 2.4 Å

PDB Description: photosynthetic reaction center from blastochloris viridis

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2jblh2:

Sequence; same for both SEQRES and ATOM records:

>d2jblh2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d2jblh2:

• d2jblh2 first appeared in SCOPe 2.01
  
• d2jblh2 appears in SCOPe 2.04
  
• d2jblh2 appears in SCOPe 2.06
  
• d2jblh2 appears in the current release, SCOPe 2.08