SCOPe 2.05: Domain d2jbab_: 2jba B:

Lineage for d2jbab_ (2jba B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186909] (4 PDB entries)

8. Domain d2jbab_: 2jba B: [165983]
   automated match to d1b00a_
   complexed with na, trs; mutant

Details for d2jbab_

PDB Entry: 2jba, 1.45 Å

PDB Description: phob response regulator receiver domain constitutively-active double mutant d53a and y102c.

PDB Compounds: (B:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d2jbab_:

Sequence; same for both SEQRES and ATOM records:

>d2jbab_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlillawmlpggsg
iqfikhlkresmtrdipvvmltargeeedrvrgletgaddcitkpfspkelvarikavmr
r

Timeline for d2jbab_:

• d2jbab_ first appeared in SCOPe 2.01
  
• d2jbab_ appears in SCOPe 2.04
  
• d2jbab_ appears in SCOPe 2.06
  
• d2jbab_ appears in the current release, SCOPe 2.08