SCOPe 2.05: Domain d2jb9a_: 2jb9 A:

Lineage for d2jb9a_ (2jb9 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186909] (4 PDB entries)

8. Domain d2jb9a_: 2jb9 A: [165980]
   automated match to d1b00a_
   mutant

Details for d2jb9a_

PDB Entry: 2jb9, 1.7 Å

PDB Description: phob response regulator receiver domain constitutively-active double mutant d10a and d53e.

PDB Compounds: (A:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d2jb9a_:

Sequence; same for both SEQRES and ATOM records:

>d2jb9a_ c.23.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
rrilvveaeapiremvcfvleqngfqpveaedydsavnqlnepwpdlillewmlpggsgi
qfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmrr
i

Timeline for d2jb9a_:

• d2jb9a_ first appeared in SCOPe 2.01
  
• d2jb9a_ appears in SCOPe 2.04
  
• d2jb9a_ appears in SCOPe 2.06
  
• d2jb9a_ appears in the current release, SCOPe 2.08