Lineage for d2jasc_ (2jas C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850213Species Mycoplasma mycoides [TaxId:44101] [187903] (3 PDB entries)
  8. 1850220Domain d2jasc_: 2jas C: [165971]
    automated match to d1j90a_
    complexed with dtp, mg

Details for d2jasc_

PDB Entry: 2jas (more details), 2.7 Å

PDB Description: structure of deoxyadenosine kinase from m.mycoides with bound datp
PDB Compounds: (C:) deoxyguanosine kinase

SCOPe Domain Sequences for d2jasc_:

Sequence, based on SEQRES records: (download)

>d2jasc_ c.37.1.0 (C:) automated matches {Mycoplasma mycoides [TaxId: 44101]}
hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkip
enklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpff
vvdaeldvktqielimnklns

Sequence, based on observed residues (ATOM records): (download)

>d2jasc_ c.37.1.0 (C:) automated matches {Mycoplasma mycoides [TaxId: 44101]}
hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenllsf
diviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdael
dvktqielimnklns

SCOPe Domain Coordinates for d2jasc_:

Click to download the PDB-style file with coordinates for d2jasc_.
(The format of our PDB-style files is described here.)

Timeline for d2jasc_: