Lineage for d1egdb1 (1egd B:242-396)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2246Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies)
  4. 2357Superfamily a.24.6: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47203] (1 family) (S)
  5. 2358Family a.24.6.1: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47204] (3 proteins)
  6. 2369Protein Medium chain acyl-CoA dehydrogenase [47207] (2 species)
  7. 2370Species Human (Homo sapiens) [TaxId:9606] [47209] (3 PDB entries)
  8. 2372Domain d1egdb1: 1egd B:242-396 [16597]
    Other proteins in same PDB: d1egda2, d1egdb2, d1egdc2, d1egdd2

Details for d1egdb1

PDB Entry: 1egd (more details), 2.4 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase

SCOP Domain Sequences for d1egdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egdb1 a.24.6.1 (B:242-396) Medium chain acyl-CoA dehydrogenase {Human (Homo sapiens)}
gagfkvamgafdkerpvvaagavglaqraldeatkyalerktfgkllvehqaisfmlaem
amkvelarmsyqraawevdsgrrntyyasiakafagdianqlatdavqilggngfnteyp
veklmrdakiyqiyggtsqiqrlivarehidkykn

SCOP Domain Coordinates for d1egdb1:

Click to download the PDB-style file with coordinates for d1egdb1.
(The format of our PDB-style files is described here.)

Timeline for d1egdb1: