Lineage for d2j96a_ (2j96 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1255931Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1256091Protein automated matches [190531] (8 species)
    not a true protein
  7. 1256113Species Mastigocladus laminosus [TaxId:83541] [187515] (2 PDB entries)
  8. 1256114Domain d2j96a_: 2j96 A: [165947]
    automated match to d1i7ya_
    complexed with pvn

Details for d2j96a_

PDB Entry: 2j96 (more details), 2.25 Å

PDB Description: the e-configuration of alfa-phycoerythrocyanin
PDB Compounds: (A:) phycoerythrocyanin alpha chain

SCOPe Domain Sequences for d2j96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j96a_ a.1.1.3 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mktplteaiaaadlrgsylsntelqavfgrfnraragleaarafanngkkwaeaaanhvy
qkfpyttqmqgpqyastpegkakcvrdidhylrtisyccvvggtgplddyvvaglkefns
alglspswyiaalefvrdnhgltgdvageantyinyainals

SCOPe Domain Coordinates for d2j96a_:

Click to download the PDB-style file with coordinates for d2j96a_.
(The format of our PDB-style files is described here.)

Timeline for d2j96a_: