Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (8 species) not a true protein |
Species Mastigocladus laminosus [TaxId:83541] [187515] (2 PDB entries) |
Domain d2j96a_: 2j96 A: [165947] automated match to d1i7ya_ complexed with pvn |
PDB Entry: 2j96 (more details), 2.25 Å
SCOPe Domain Sequences for d2j96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j96a_ a.1.1.3 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]} mktplteaiaaadlrgsylsntelqavfgrfnraragleaarafanngkkwaeaaanhvy qkfpyttqmqgpqyastpegkakcvrdidhylrtisyccvvggtgplddyvvaglkefns alglspswyiaalefvrdnhgltgdvageantyinyainals
Timeline for d2j96a_: