SCOPe 2.07: Domain d2j6wa_: 2j6w A:

Lineage for d2j6wa_ (2j6w A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.6: RUNT domain [81318] (2 proteins)
   automatically mapped to Pfam PF00853

6. Protein automated matches [190872] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188223] (1 PDB entry)

8. Domain d2j6wa_: 2j6w A: [165917]
   automated match to d1cmoa_
   complexed with cl; mutant

Details for d2j6wa_

PDB Entry: 2j6w, 2.6 Å

PDB Description: r164n mutant of the runx1 runt domain

PDB Compounds: (A:) runt-related transcription factor 1

SCOPe Domain Sequences for d2j6wa_:

Sequence; same for both SEQRES and ATOM records:

>d2j6wa_ b.2.5.6 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
smvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagn
denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhnaikit
vdgp

Timeline for d2j6wa_:

• d2j6wa_ first appeared in SCOPe 2.01
  
• d2j6wa_ appears in SCOPe 2.06
  
• d2j6wa_ appears in the current release, SCOPe 2.08