Lineage for d2j4ur_ (2j4u R:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2575890Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2575961Protein automated matches [190289] (6 species)
    not a true protein
  7. 2575972Species Escherichia coli [TaxId:562] [187889] (8 PDB entries)
  8. 2575995Domain d2j4ur_: 2j4u R: [165895]
    automated match to d1osma_

Details for d2j4ur_

PDB Entry: 2j4u (more details), 2.99 Å

PDB Description: E.coli OmpC - camel Lactoferrin complex
PDB Compounds: (R:) outer membrane protein c precursor

SCOPe Domain Sequences for d2j4ur_:

Sequence, based on SEQRES records: (download)

>d2j4ur_ f.4.3.1 (R:) automated matches {Escherichia coli [TaxId: 562]}
aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgv
ggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytq
tynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdv
gatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf

Sequence, based on observed residues (ATOM records): (download)

>d2j4ur_ f.4.3.1 (R:) automated matches {Escherichia coli [TaxId: 562]}
aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdggsitydye
gfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgs
lgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnkn
mstyvdykinllddnqftrdagintdnivalglvyqf

SCOPe Domain Coordinates for d2j4ur_:

Click to download the PDB-style file with coordinates for d2j4ur_.
(The format of our PDB-style files is described here.)

Timeline for d2j4ur_: