Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
Protein automated matches [190728] (15 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [187893] (2 PDB entries) |
Domain d2j4jd_: 2j4j D: [165870] automated match to d2bmua1 complexed with 4tc, acp, co, mg, u5p |
PDB Entry: 2j4j (more details), 2.1 Å
SCOPe Domain Sequences for d2j4jd_:
Sequence, based on SEQRES records: (download)
>d2j4jd_ c.73.1.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
>d2j4jd_ c.73.1.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkileelldplaik iverskirvivmnyrklnriidilkgeevssiiepv
Timeline for d2j4jd_: