SCOPe 2.03: Domain d2j41c_: 2j41 C:

Lineage for d2j41c_ (2j41 C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187532] (4 PDB entries)

8. Domain d2j41c_: 2j41 C: [165862]
   automated match to d1s96a_
   complexed with 5gp, k, so4

Details for d2j41c_

PDB Entry: 2j41, 1.9 Å

PDB Description: crystal structure of staphylococcus aureus guanylate monophosphate kinase

PDB Compounds: (C:) Guanylate kinase

SCOPe Domain Sequences for d2j41c_:

Sequence, based on SEQRES records:

>d2j41c_ c.37.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
kgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdafe
alikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfifl
appslehlrerlvgrgtesdekiqsrinearkevemmnlydyvvvndevelaknriqciv
eaehlkrerveak

Sequence, based on observed residues (ATOM records):

>d2j41c_ c.37.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
kgllivlsgpsgvgkgtvrkrifedpstsykysismttrqmregevdgvdyffktrdafe
alikddqfieyaeyvgnyygtpvqyvkdtmdeghdvfleievegakqvrkkfpdalfifl
appsqsrinearkevemmnlydyvvvndevelaknriqciveaehlkrerveak

Timeline for d2j41c_:

• d2j41c_ first appeared in SCOPe 2.01
  
• d2j41c_ appears in SCOPe 2.02
  
• d2j41c_ appears in SCOPe 2.04
  
• d2j41c_ appears in the current release, SCOPe 2.08