Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily) unusual fold |
Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) |
Family d.171.1.0: automated matches [191465] (1 protein) not a true family |
Protein automated matches [190726] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187887] (56 PDB entries) |
Domain d2j3oc_: 2j3o C: [165846] automated match to d1jc9a_ complexed with act, ca, nag |
PDB Entry: 2j3o (more details), 2.65 Å
SCOPe Domain Sequences for d2j3oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j3oc_ d.171.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pcltgprtckdlldrghflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrvdgsvdfy rdwatykqgfgsrlgefwlgndnihaltaqgtselrtdlvdfednyqfakyrsfkvadea ekynlvlgafvegsagdsltfhnnqsfstkdqdndlntgncavmfqgawwyknchtsnln grylrgthgsfanginwksgkgynysykvsemkvrpa
Timeline for d2j3oc_: