Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily) unusual fold |
Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) |
Family d.171.1.0: automated matches [191465] (1 protein) not a true family |
Protein automated matches [190726] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187887] (56 PDB entries) |
Domain d2j2pc_: 2j2p C: [165824] automated match to d1jc9a_ complexed with bma, ca, sc2 |
PDB Entry: 2j2p (more details), 2.8 Å
SCOPe Domain Sequences for d2j2pc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j2pc_ d.171.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} prtckdlldrghflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrvdgsvdfyrdwat ykqgfgsrlgefwlgndnihaltaqgtselrtdlvdfednyqfakyrsfkvadeaekynl vlgafvegsagdsltfhnnqsfstkdqdndlntgncavmfqgawwyknchtsnlngrylr gthgsfanginwksgkgynysykvsemkvrpa
Timeline for d2j2pc_: