Lineage for d2j0la_ (2j0l A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435613Protein automated matches [190091] (11 species)
    not a true protein
  7. 1435633Species Chicken (Gallus gallus) [TaxId:9031] [187329] (6 PDB entries)
  8. 1435637Domain d2j0la_: 2j0l A: [165790]
    automated match to d1mp8a_
    complexed with anp, mg, so4

Details for d2j0la_

PDB Entry: 2j0l (more details), 2.3 Å

PDB Description: crystal structure of a the active conformation of the kinase domain of focal adhesion kinase with a phosphorylated activation loop.
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2j0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0la_ d.144.1.7 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
strdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflq
ealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayql
stalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwma
pesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncppt
lyslmtkcwaydpsrrprftelkaqlstileeeklq

SCOPe Domain Coordinates for d2j0la_:

Click to download the PDB-style file with coordinates for d2j0la_.
(The format of our PDB-style files is described here.)

Timeline for d2j0la_: