SCOPe 2.08: Domain d2j0ia_: 2j0i A:

Lineage for d2j0ia_ (2j0i A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d2j0ia_: 2j0i A: [165789]
   automated match to d1f3mc_
   complexed with edo

Details for d2j0ia_

PDB Entry: 2j0i, 1.6 Å

PDB Description: crystal structure of the human p21-activated kinase 4

PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d2j0ia_:

Sequence; same for both SEQRES and ATOM records:

>d2j0ia_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqqr
rellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqiaa
vclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgtp
ywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknlh
kvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnr

Timeline for d2j0ia_:

• d2j0ia_ first appeared in SCOPe 2.01
  
• d2j0ia_ appears in SCOPe 2.07