Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins) automatically mapped to Pfam PF00197 |
Protein automated matches [190504] (2 species) not a true protein |
Species Barley (Hordeum vulgare) [TaxId:4513] [187881] (1 PDB entry) |
Domain d2iwtb_: 2iwt B: [165727] Other proteins in same PDB: d2iwta_ automated match to d1avac_ complexed with flc |
PDB Entry: 2iwt (more details), 2.3 Å
SCOPe Domain Sequences for d2iwtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iwtb_ b.42.4.1 (B:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} aadpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfp vritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsp sgrenafriekysgaevheyklmssgdwcqdlgvfrdlkggawflgatepyhvvvfkkap pa
Timeline for d2iwtb_: