Lineage for d2iwmd_ (2iwm D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988501Family d.153.1.3: Penicillin V acylase [56248] (2 proteins)
    automatically mapped to Pfam PF02275
  6. 2988516Protein automated matches [190722] (1 species)
    not a true protein
  7. 2988517Species Bacillus sphaericus [TaxId:1421] [188588] (4 PDB entries)
  8. 2988522Domain d2iwmd_: 2iwm D: [165723]
    automated match to d3pvaa_
    mutant

Details for d2iwmd_

PDB Entry: 2iwm (more details), 2.5 Å

PDB Description: precursor mutant cys1ser of penicillin v acylase from bacillus sphaericus
PDB Compounds: (D:) penicillin acylase

SCOPe Domain Sequences for d2iwmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwmd_ d.153.1.3 (D:) automated matches {Bacillus sphaericus [TaxId: 1421]}
mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
risavslmaenlnsqdlitfewdrkqdikqlnq

SCOPe Domain Coordinates for d2iwmd_:

Click to download the PDB-style file with coordinates for d2iwmd_.
(The format of our PDB-style files is described here.)

Timeline for d2iwmd_: