SCOPe 2.03: Domain d2iu2a_: 2iu2 A:

Lineage for d2iu2a_ (2iu2 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187027] (15 PDB entries)

8. Domain d2iu2a_: 2iu2 A: [165691]
   automated match to d1fhaa_
   complexed with gol, zn; mutant

Details for d2iu2a_

PDB Entry: 2iu2, 1.8 Å

PDB Description: recombinant human h ferritin, k86q, e27d and e107d mutant, soaked with zn ions

PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d2iu2a_:

Sequence; same for both SEQRES and ATOM records:

>d2iu2a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinldlyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhldknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Timeline for d2iu2a_:

• d2iu2a_ first appeared in SCOPe 2.01
  
• d2iu2a_ appears in SCOPe 2.02
  
• d2iu2a_ appears in SCOPe 2.04
  
• d2iu2a_ appears in the current release, SCOPe 2.08