SCOPe 2.03: Domain d2impa_: 2imp A:

Lineage for d2impa_ (2imp A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187807] (4 PDB entries)

8. Domain d2impa_: 2imp A: [165612]
   automated match to d1wnba_
   complexed with lac, nai, so4

Details for d2impa_

PDB Entry: 2imp, 2.1 Å

PDB Description: crystal structure of lactaldehyde dehydrogenase from e. coli: the ternary complex with lactate (occupancy 0.5) and nadh. crystals soaked with (l)-lactate.

PDB Compounds: (A:) Lactaldehyde dehydrogenase

SCOPe Domain Sequences for d2impa_:

Sequence; same for both SEQRES and ATOM records:

>d2impa_ c.82.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
vpvqhpmyidgqfvtwrgdawidvvnpateavisripdgqaedarkaidaaeraqpewea
lpaieraswlrkisagireraseisaliveeggkiqqlaevevaftadyidymaewarry
egeiiqsdrpgenillfkralgvttgilpwnfpffliarkmapalltgntivikpseftp
nnaiafakivdeiglprgvfnlvlgrgetvgqelagnpkvamvsmtgsvsagekimataa
knitkvclelggkapaivmddadlelavkaivdsrvinsgqvcncaervyvqkgiydqfv
nrlgeamqavqfgnpaerndiamgplinaaalerveqkvaraveegarvafggkavegkg
yyypptllldvrqemsimheetfgpvlpvvafdtledaismandsdygltssiytqnlnv
amkaikglkfgetyinrenfeamqgfhagwrksgiggadgkhglheylqtqvvylqs

Timeline for d2impa_:

• d2impa_ first appeared in SCOPe 2.01
  
• d2impa_ appears in SCOPe 2.02
  
• d2impa_ appears in SCOPe 2.04
  
• d2impa_ appears in the current release, SCOPe 2.08