Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (29 species) not a true protein |
Species Escherichia coli [TaxId:562] [187807] (4 PDB entries) |
Domain d2impa_: 2imp A: [165612] automated match to d1wnba_ complexed with lac, nai, so4 |
PDB Entry: 2imp (more details), 2.1 Å
SCOPe Domain Sequences for d2impa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2impa_ c.82.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} vpvqhpmyidgqfvtwrgdawidvvnpateavisripdgqaedarkaidaaeraqpewea lpaieraswlrkisagireraseisaliveeggkiqqlaevevaftadyidymaewarry egeiiqsdrpgenillfkralgvttgilpwnfpffliarkmapalltgntivikpseftp nnaiafakivdeiglprgvfnlvlgrgetvgqelagnpkvamvsmtgsvsagekimataa knitkvclelggkapaivmddadlelavkaivdsrvinsgqvcncaervyvqkgiydqfv nrlgeamqavqfgnpaerndiamgplinaaalerveqkvaraveegarvafggkavegkg yyypptllldvrqemsimheetfgpvlpvvafdtledaismandsdygltssiytqnlnv amkaikglkfgetyinrenfeamqgfhagwrksgiggadgkhglheylqtqvvylqs
Timeline for d2impa_: