SCOPe 2.01: Domain d2ig3b_: 2ig3 B:

Lineage for d2ig3b_ (2ig3 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (10 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [187859] (2 PDB entries)

8. Domain d2ig3b_: 2ig3 B: [165539]
   automated match to d1ux8a_
   complexed with act, cyn, hem, so4

Details for d2ig3b_

PDB Entry: 2ig3, 2.15 Å

PDB Description: crystal structure of group iii truncated hemoglobin from campylobacter jejuni

PDB Compounds: (B:) Group III truncated haemoglobin

SCOPe Domain Sequences for d2ig3b_:

Sequence; same for both SEQRES and ATOM records:

>d2ig3b_ a.1.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 197]}
mkfetinqesiaklmeifyekvrkdkdlgpifnnaigtsdeewkehkakignfwagmllg
egdyngqplkkhldlppfpqeffeiwlklfeeslnivyneemknvilqraqmiashfqnm
lyky

Timeline for d2ig3b_:

• d2ig3b_ is new in SCOPe 2.01-stable
  
• d2ig3b_ appears in SCOPe 2.02
  
• d2ig3b_ appears in the current release, SCOPe 2.08