Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
Protein automated matches [190710] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries) |
Domain d2if5a_: 2if5 A: [165531] automated match to d1buoa_ complexed with pr |
PDB Entry: 2if5 (more details), 2 Å
SCOPe Domain Sequences for d2if5a_:
Sequence, based on SEQRES records: (download)
>d2if5a_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} igipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsgav vdqqnvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlld
>d2if5a_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} igipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsqqn vyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlld
Timeline for d2if5a_: