Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186896] (13 PDB entries) |
Domain d2if0a_: 2if0 A: [165529] automated match to d2f7sa1 complexed with gdp, mg |
PDB Entry: 2if0 (more details), 2.8 Å
SCOPe Domain Sequences for d2if0a_:
Sequence, based on SEQRES records: (download)
>d2if0a_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqgadgasgka fkvhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycen pdivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrm ekcv
>d2if0a_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydafkvhlqlwdt aglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlignka dlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrmekcv
Timeline for d2if0a_: