Lineage for d2idxc_ (2idx C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318511Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2318530Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 2318531Protein automated matches [190652] (6 species)
    not a true protein
  7. 2318546Species Human (Homo sapiens) [TaxId:9606] [187855] (3 PDB entries)
  8. 2318552Domain d2idxc_: 2idx C: [165520]
    automated match to d1rtyb_
    complexed with atp, cl, mg, so4

Details for d2idxc_

PDB Entry: 2idx (more details), 2.5 Å

PDB Description: structure of human atp:cobalamin adenosyltransferase bound to atp.
PDB Compounds: (C:) Cob(I)yrinic acid a,c-diamide adenosyltransferase

SCOPe Domain Sequences for d2idxc_:

Sequence, based on SEQRES records: (download)

>d2idxc_ a.25.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeelqki
qctlqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilpsggk
issalhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnqeki
ymk

Sequence, based on observed residues (ATOM records): (download)

>d2idxc_ a.25.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvthtfaeelqkiqct
lqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilpsggkiss
alhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnqekiymk

SCOPe Domain Coordinates for d2idxc_:

Click to download the PDB-style file with coordinates for d2idxc_.
(The format of our PDB-style files is described here.)

Timeline for d2idxc_: