Lineage for d2ideh_ (2ide H:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417485Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 1417491Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 1417492Protein automated matches [190706] (5 species)
    not a true protein
  7. 1417509Species Thermus thermophilus [TaxId:300852] [187852] (5 PDB entries)
  8. 1417531Domain d2ideh_: 2ide H: [165504]
    automated match to d1ekra_
    complexed with po4

Details for d2ideh_

PDB Entry: 2ide (more details), 1.9 Å

PDB Description: Crystal Structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from Thermus Theromophilus HB8
PDB Compounds: (H:) Molybdenum cofactor biosynthesis protein C

SCOPe Domain Sequences for d2ideh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ideh_ d.58.21.0 (H:) automated matches {Thermus thermophilus [TaxId: 300852]}
grprmvdvtekpetfrtataeafvelteealsalekggvgkgdplvvaqlagilaakkta
dliplchplpltgvevrvellkaekrvrieatvktkaetgvemeamtacavaaltvydml
kaaskglvisqvrllhkaggksgewrre

SCOPe Domain Coordinates for d2ideh_:

Click to download the PDB-style file with coordinates for d2ideh_.
(The format of our PDB-style files is described here.)

Timeline for d2ideh_: