Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Cnidopus japonicus [TaxId:380086] [188533] (2 PDB entries) |
Domain d2ib6h_: 2ib6 H: [165482] automated match to d1xqma_ complexed with po4; mutant |
PDB Entry: 2ib6 (more details), 2 Å
SCOPe Domain Sequences for d2ib6h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ib6h_ d.22.1.1 (H:) automated matches {Cnidopus japonicus [TaxId: 380086]} isdnvriklymegtvnnhhfmceaegegkpyegtqmenikvtkggplpfsfdiltpncql gsvaitkytsgipdyfkqsfpegftwerttiyedgaylttqqetkldgnclvynikilgc nfppngpvmqkktqgwepccemrytrdgvlcgqtlmalkcadgnhltchlrttyrskkaa kalqmppfhfsdhrpeivkvsengtlfeqhessvarycqtcpsklghn
Timeline for d2ib6h_: