Lineage for d2i7fa_ (2i7f A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120372Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1120373Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1120531Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 1120532Protein automated matches [190701] (3 species)
    not a true protein
  7. 1120539Species Sphingobium yanoikuyae [TaxId:13690] [187845] (1 PDB entry)
  8. 1120540Domain d2i7fa_: 2i7f A: [165422]
    automated match to d1fqta_
    complexed with cit, fes, so4

Details for d2i7fa_

PDB Entry: 2i7f (more details), 1.9 Å

PDB Description: sphingomonas yanoikuyae b1 ferredoxin
PDB Compounds: (A:) Ferredoxin component of dioxygenase

SCOPe Domain Sequences for d2i7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i7fa_ b.33.1.0 (A:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
nklrlcqvasvkdgepvavyqekmpalavynvdgevfvtdnlcthgnamltdgyqdgtii
ecpfhggsfdiatgaakafpcqipiktypvtiedgwvcidqp

SCOPe Domain Coordinates for d2i7fa_:

Click to download the PDB-style file with coordinates for d2i7fa_.
(The format of our PDB-style files is described here.)

Timeline for d2i7fa_: