![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (23 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187843] (1 PDB entry) |
![]() | Domain d2i62d_: 2i62 D: [165407] automated match to d2a14a1 complexed with sah |
PDB Entry: 2i62 (more details), 1.8 Å
SCOPe Domain Sequences for d2i62d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i62d_ c.66.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ftskdtylshfnprdylekyysfgsrhcaeneilrhllknlfkifclgavkgellidigs gptiyqllsacesfteiivsdytdqnlwelqkwlkkepgafdwspvvtyvcdlegnrmkg pekeeklrraikqvlkcdvtqsqplggvslppadcllstlcldaacpdlpayrtalrnlg sllkpggflvmvdalkssyymigeqkfsslplgwetvrdaveeagytieqfevisqnyss ttsnneglfslvgrkpgrs
Timeline for d2i62d_: