Lineage for d2i62b_ (2i62 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379620Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1379621Protein automated matches [190689] (42 species)
    not a true protein
  7. 1379778Species Mouse (Mus musculus) [TaxId:10090] [187843] (1 PDB entry)
  8. 1379780Domain d2i62b_: 2i62 B: [165405]
    automated match to d2a14a1
    complexed with sah

Details for d2i62b_

PDB Entry: 2i62 (more details), 1.8 Å

PDB Description: mouse nicotinamide n-methyltransferase
PDB Compounds: (B:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d2i62b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i62b_ c.66.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gftskdtylshfnprdylekyysfgsrhcaeneilrhllknlfkifclgavkgellidig
sgptiyqllsacesfteiivsdytdqnlwelqkwlkkepgafdwspvvtyvcdlegnrmk
gpekeeklrraikqvlkcdvtqsqplggvslppadcllstlcldaacpdlpayrtalrnl
gsllkpggflvmvdalkssyymigeqkfsslplgwetvrdaveeagytieqfevisqnys
sttsnneglfslvgrkpgrse

SCOPe Domain Coordinates for d2i62b_:

Click to download the PDB-style file with coordinates for d2i62b_.
(The format of our PDB-style files is described here.)

Timeline for d2i62b_: