Lineage for d2i5zo_ (2i5z O:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813016Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2813017Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 2813018Family b.76.1.1: Outer surface protein [51088] (3 proteins)
  6. 2813030Protein automated matches [190440] (3 species)
    not a true protein
  7. 2813046Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (24 PDB entries)
  8. 2813049Domain d2i5zo_: 2i5z O: [165402]
    automated match to d1fj1e_
    complexed with pg4; mutant

Details for d2i5zo_

PDB Entry: 2i5z (more details), 1.2 Å

PDB Description: the crystal structure of ospa mutant
PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d2i5zo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5zo_ b.76.1.1 (O:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
ltisddlgqttlevfksdgstlvskkvtskdkssteekanekgevsekiitradgtrley
tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsvelndtdss
aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde
iknalk

SCOPe Domain Coordinates for d2i5zo_:

Click to download the PDB-style file with coordinates for d2i5zo_.
(The format of our PDB-style files is described here.)

Timeline for d2i5zo_: