Lineage for d2i0ua_ (2i0u A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925596Protein automated matches [190139] (19 species)
    not a true protein
  7. 925708Species Vipera nikolskii [TaxId:110206] [187834] (1 PDB entry)
  8. 925709Domain d2i0ua_: 2i0u A: [165364]
    automated match to d1jltb_
    complexed with ca, so4, tfa, trt

Details for d2i0ua_

PDB Entry: 2i0u (more details), 2.2 Å

PDB Description: Crystal structures of phospholipases A2 from Vipera nikolskii venom revealing Triton X-100 bound in hydrophobic channel
PDB Compounds: (A:) Basic subunit of heterodimer phospholipase A2

SCOPe Domain Sequences for d2i0ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0ua_ a.133.1.2 (A:) automated matches {Vipera nikolskii [TaxId: 110206]}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiyaysfkkgnivcgknngclrdicecdrvaancfhqnqntynknykflsssrcrqtse
qc

SCOPe Domain Coordinates for d2i0ua_:

Click to download the PDB-style file with coordinates for d2i0ua_.
(The format of our PDB-style files is described here.)

Timeline for d2i0ua_: