SCOPe 2.08: Domain d2hzea1: 2hze A:1-107

Lineage for d2hzea1 (2hze A:1-107)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Ectromelia virus [TaxId:265874] [187832] (2 PDB entries)

8. Domain d2hzea1: 2hze A:1-107 [165338]
   Other proteins in same PDB: d2hzea2, d2hzeb2
   automated match to d1jhba_

Details for d2hzea1

PDB Entry: 2hze, 1.8 Å

PDB Description: Crystal structures of a poxviral glutaredoxin in the oxidized and reduced states show redox-correlated structural changes

PDB Compounds: (A:) Glutaredoxin-1

SCOPe Domain Sequences for d2hzea1:

Sequence; same for both SEQRES and ATOM records:

>d2hzea1 c.47.1.0 (A:1-107) automated matches {Ectromelia virus [TaxId: 265874]}
maeefvqqrlannkvtifvkytcpfcrnaldilnkfsfkrgayeivdikefkpenelrdy
feqitggktvpriffgktsiggysdlleidnmdalgdilssigvlrt

Timeline for d2hzea1:

• d2hzea1 first appeared in SCOPe 2.01, called d2hzea_
  
• d2hzea1 appears in SCOPe 2.07