SCOP 1.65: Domain d1le4__: 1le4 -

Lineage for d1le4__ (1le4 -)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.1: Apolipoprotein [47162] (1 family)

5. Family a.24.1.1: Apolipoprotein [47163] (1 protein)
   Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
   family may also include the five-helical bundle protein Apolipophorin-III

6. Protein Apolipoprotein E [88703] (3 species)

7. Species Human (Homo sapiens), E4 [TaxId:9606] [47169] (3 PDB entries)

8. Domain d1le4__: 1le4 - [16528]
   mutant

Details for d1le4__

PDB Entry: 1le4, 2.5 Å

PDB Description: structural basis for altered function in the common mutants of human apolipoprotein-e

SCOP Domain Sequences for d1le4__:

Sequence; same for both SEQRES and ATOM records:

>d1le4__ a.24.1.1 (-) Apolipoprotein E {Human (Homo sapiens), E4}
qrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeqlt
pvaeetrarlskelqaaqarlgadmedvrgrlvqyrgevqamlgqsteelrvrlashlrk
lrkrllrdaddlqkrlavy

Timeline for d1le4__:

• d1le4__ first appeared (with stable ids) in SCOP 1.55
  
• d1le4__ appears in SCOP 1.63
  
• d1le4__ appears in SCOP 1.67
  
• d1le4__ appears in the current release, SCOPe 2.08, called d1le4a_