Lineage for d1or2a_ (1or2 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211870Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 211871Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. 211872Family a.24.1.1: Apolipoprotein [47163] (3 proteins)
    Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
    family may also include the five-helical bundle protein Apolipophorin-III
  6. 211877Protein Apolipoprotein E3 [47164] (1 species)
  7. 211878Species Human (Homo sapiens) [TaxId:9606] [47165] (7 PDB entries)
  8. 211885Domain d1or2a_: 1or2 A: [16525]
    truncation mutant 165

Details for d1or2a_

PDB Entry: 1or2 (more details), 2.5 Å

PDB Description: apolipoprotein e3 (apoe3) truncation mutant 165

SCOP Domain Sequences for d1or2a_:

Sequence, based on SEQRES records: (download)

>d1or2a_ a.24.1.1 (A:) Apolipoprotein E3 {Human (Homo sapiens)}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrkrllrdaddlqkrlavyq

Sequence, based on observed residues (ATOM records): (download)

>d1or2a_ a.24.1.1 (A:) Apolipoprotein E3 {Human (Homo sapiens)}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
skelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlrklrkrllrdad
dlqkrlavyq

SCOP Domain Coordinates for d1or2a_:

Click to download the PDB-style file with coordinates for d1or2a_.
(The format of our PDB-style files is described here.)

Timeline for d1or2a_: