SCOPe 2.04: Domain d2htec_: 2hte C:

Lineage for d2htec_ (2hte C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (47 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [187826] (13 PDB entries)

8. Domain d2htec_: 2hte C: [165245]
   automated match to d1xj5a_
   complexed with 1pg, mta, so4, unx

Details for d2htec_

PDB Entry: 2hte, 2 Å

PDB Description: The crystal structure of spermidine synthase from p. falciparum in complex with 5'-methylthioadenosine

PDB Compounds: (C:) spermidine synthase

SCOPe Domain Sequences for d2htec_:

Sequence; same for both SEQRES and ATOM records:

>d2htec_ c.66.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdef
ayhemmthvpmtvskepknvlvvgggdggiirelckyksvenidiceidetvievskiyf
kniscgyedkrvnvfiedaskflenvtntydviivdssdpigpaetlfnqnfyekiynal
kpngycvaqceslwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtg
ltkpnkkleskefadlkyynyenhsaafklpafllkeieni

Timeline for d2htec_:

• d2htec_ first appeared in SCOPe 2.01
  
• d2htec_ appears in SCOPe 2.03
  
• d2htec_ appears in SCOPe 2.05
  
• d2htec_ appears in the current release, SCOPe 2.08