Lineage for d2ht8a_ (2ht8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2808129Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2808130Protein automated matches [190692] (20 species)
    not a true protein
  7. 2808214Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries)
  8. 2808273Domain d2ht8a_: 2ht8 A: [165242]
    automated match to d1inga_
    complexed with g39

Details for d2ht8a_

PDB Entry: 2ht8 (more details), 2.4 Å

PDB Description: N8 neuraminidase in complex with oseltamivir
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d2ht8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht8a_ b.68.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqtdisfngghieecscypndgkvecvcrdgwtgtnrpvlvispdlsyrvgylcagip
sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdi

SCOPe Domain Coordinates for d2ht8a_:

Click to download the PDB-style file with coordinates for d2ht8a_.
(The format of our PDB-style files is described here.)

Timeline for d2ht8a_: