Class a: All alpha proteins [46456] (179 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.1: Apolipoprotein [47162] (1 family) |
Family a.24.1.1: Apolipoprotein [47163] (1 protein) Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1 family may also include the five-helical bundle protein Apolipophorin-III |
Protein Apolipoprotein E [88703] (3 species) |
Species Human (Homo sapiens), E3 [TaxId:9606] [47165] (7 PDB entries) |
Domain d1lpe__: 1lpe - [16524] |
PDB Entry: 1lpe (more details), 2.25 Å
SCOP Domain Sequences for d1lpe__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lpe__ a.24.1.1 (-) Apolipoprotein E {Human (Homo sapiens), E3} gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr klrkrllrdaddlqkrlavyqaga
Timeline for d1lpe__: