SCOPe 2.08: Domain d2hqja1: 2hqj A:2-179

Lineage for d2hqja1 (2hqj A:2-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (22 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [187822] (1 PDB entry)

8. Domain d2hqja1: 2hqj A:2-179 [165208]
   Other proteins in same PDB: d2hqja2
   automated match to d1dywa_
   complexed with po4

Details for d2hqja1

PDB Entry: 2hqj, 2 Å

PDB Description: cyclophilin from leishmania major

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2hqja1:

Sequence; same for both SEQRES and ATOM records:

>d2hqja1 b.62.1.1 (A:2-179) automated matches {Leishmania major [TaxId: 5664]}
tnpkvffdisidnkaagrivmelyadtvpktaenfralctgekgkgrsgkplhykssvfh
rvipnfmiqggdftrgngtggesiygttfrdesfsgkagrhtglgclsmanagpntngsq
ffictaatpwldgkhvvfgrvidgldvvkkverlgsssgktrsrivvsdcgevaadks

Timeline for d2hqja1:

• d2hqja1 first appeared in SCOPe 2.01, called d2hqja_
  
• d2hqja1 appears in SCOPe 2.07