SCOPe 2.04: Domain d2hq1a_: 2hq1 A:

Lineage for d2hq1a_ (2hq1 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [187820] (1 PDB entry)

8. Domain d2hq1a_: 2hq1 A: [165205]
   automated match to d1edoa_

Details for d2hq1a_

PDB Entry: 2hq1, 1.9 Å

PDB Description: crystal structure of orf 1438 a putative glucose/ribitol dehydrogenase from clostridium thermocellum

PDB Compounds: (A:) glucose/ribitol dehydrogenase

SCOPe Domain Sequences for d2hq1a_:

Sequence, based on SEQRES records:

>d2hq1a_ c.2.1.0 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
mqlkgktaivtgssrglgkaiawklgnmganivlngspastsldataeefkaaginvvva
kgdvknpedvenmvktamdafgridilvnnagitrdtlmlkmsekdwddvlntnlksayl
ctkavskimlkqksgkiinitsiagiignagqanyaaskagligftksiakefaakgiyc
navapgiiktdmtdvlpdkvkemylnniplkrfgtpeevanvvgflasddsnyitgqvin
idggl

Sequence, based on observed residues (ATOM records):

>d2hq1a_ c.2.1.0 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
mqlkgktaivtgssrglgkaiawklgnmganivlngspastsldataeefkaaginvvva
kgdvknpedvenmvktamdafgridilvnnawddvlntnlksaylctkavskimlkqksg
kiinitsqanyaaskagligftksiakefaakgiycnavapgiiktdmtdvlpdkvkemy
lnniplkrfgtpeevanvvgflasddsnyitgqvinidggl

Timeline for d2hq1a_:

• d2hq1a_ first appeared in SCOPe 2.01
  
• d2hq1a_ appears in SCOPe 2.03
  
• d2hq1a_ appears in SCOPe 2.05
  
• d2hq1a_ appears in the current release, SCOPe 2.08