SCOPe 2.03: Domain d2hnkc_: 2hnk C:

Lineage for d2hnkc_ (2hnk C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (42 species)
   not a true protein

7. Species Leptospira interrogans [TaxId:173] [187817] (1 PDB entry)

8. Domain d2hnkc_: 2hnk C: [165161]
   automated match to d1suia1
   complexed with peg, sah, so4

Details for d2hnkc_

PDB Entry: 2hnk, 2.3 Å

PDB Description: crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans

PDB Compounds: (C:) SAM-dependent O-methyltransferase

SCOPe Domain Sequences for d2hnkc_:

Sequence; same for both SEQRES and ATOM records:

>d2hnkc_ c.66.1.0 (C:) automated matches {Leptospira interrogans [TaxId: 173]}
rknisltesleeyifrnsvrepdsflklrketgtlaqanmqispeegqflniltkisgak
riieigtftgysslcfasalpedgkilccdvseewtnvarkywkenglenkiflklgsal
etlqvlidsksapswasdfafgpssidlffldadkenypnyyplilkllkpgglliadnv
lwdgsvadlshqepstvgirkfnelvyndslvdvslvpiadgvslvrkrle

Timeline for d2hnkc_:

• d2hnkc_ first appeared in SCOPe 2.01
  
• d2hnkc_ appears in SCOPe 2.02
  
• d2hnkc_ appears in SCOPe 2.04
  
• d2hnkc_ appears in the current release, SCOPe 2.08, called d2hnkc1