Lineage for d2hnkb_ (2hnk B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1612879Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1612880Protein automated matches [190689] (47 species)
    not a true protein
  7. 1613004Species Leptospira interrogans [TaxId:173] [187817] (1 PDB entry)
  8. 1613006Domain d2hnkb_: 2hnk B: [165160]
    automated match to d1suia1
    complexed with peg, sah, so4

Details for d2hnkb_

PDB Entry: 2hnk (more details), 2.3 Å

PDB Description: crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans
PDB Compounds: (B:) SAM-dependent O-methyltransferase

SCOPe Domain Sequences for d2hnkb_:

Sequence, based on SEQRES records: (download)

>d2hnkb_ c.66.1.0 (B:) automated matches {Leptospira interrogans [TaxId: 173]}
srknisltesleeyifrnsvrepdsflklrketgtlaqanmqispeegqflniltkisga
kriieigtftgysslcfasalpedgkilccdvseewtnvarkywkenglenkiflklgsa
letlqvlidsksapswasdfafgpssidlffldadkenypnyyplilkllkpgglliadn
vlwdgsvadlshqepstvgirkfnelvyndslvdvslvpiadgvslvrkrleh

Sequence, based on observed residues (ATOM records): (download)

>d2hnkb_ c.66.1.0 (B:) automated matches {Leptospira interrogans [TaxId: 173]}
srknisltesleeyifrnsvrepdsflklrketgtlaqnmqispeegqflniltkisgak
riieigtftgysslcfasalpedgkilccdvseewtnvarkywkenglenkiflklgsal
etlqvlidsksapswasdfafgpssidlffldadkenypnyyplilkllkpgglliadnv
lwdgsvadlshqepstvgirkfnelvyndslvdvslvpiadgvslvrkrleh

SCOPe Domain Coordinates for d2hnkb_:

Click to download the PDB-style file with coordinates for d2hnkb_.
(The format of our PDB-style files is described here.)

Timeline for d2hnkb_: