Lineage for d1fz4f_ (1fz4 F:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.23: Open three-helical up-and-down bundle [47143] (4 superfamilies) 
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) 
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) Species Methylococcus capsulatus [TaxId:414] [47155] (10 PDB entries) 
Domain d1fz4f_: 1fz4 F: [16515]
Other proteins in same PDB: d1fz4a_, d1fz4b_, d1fz4c_, d1fz4d_
Details for d1fz4f_
PDB Entry: 1fz4 (more details), 2.38 Å
PDB Description: methane monooxygenase hydroxylase, form iii soaked at ph 8.5 (0.1 m tris)
SCOP Domain Sequences for d1fz4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fz4f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph
SCOP Domain Coordinates for d1fz4f_:
Click to download the PDB-style file with coordinates for d1fz4f_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fz4f_:
- d1fz4f_ appears in SCOP 1.57
- d1fz4f_ appears in the current release, SCOPe 2.08
View in 3D
