Lineage for d2hldy_ (2hld Y:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371047Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1371195Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1371226Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 1371227Protein automated matches [190687] (1 species)
    not a true protein
  7. 1371228Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (3 PDB entries)
  8. 1371233Domain d2hldy_: 2hld Y: [165138]
    automated match to d1bmfg_
    complexed with anp, mg, po4

Details for d2hldy_

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (Y:) ATP synthase gamma chain, mitochondrial

SCOPe Domain Sequences for d2hldy_:

Sequence, based on SEQRES records: (download)

>d2hldy_ c.49.2.0 (Y:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgas

Sequence, based on observed residues (ATOM records): (download)

>d2hldy_ c.49.2.0 (Y:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmditsdkglcgsihsql
akavrrhlndqpnavtigdkikmqllrthpningigkdaptfqesaliadkllsvmkais
ifyndpvsslsfepseytlanqmltamaqgyaaeisarrnamdnasknagdminrysily
nrtrqavitnelvdiitgas

SCOPe Domain Coordinates for d2hldy_:

Click to download the PDB-style file with coordinates for d2hldy_.
(The format of our PDB-style files is described here.)

Timeline for d2hldy_: