Lineage for d2hldp_ (2hld P:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855807Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1855955Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1855986Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 1855987Protein automated matches [190687] (2 species)
    not a true protein
  7. 1855990Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (6 PDB entries)
  8. 1855994Domain d2hldp_: 2hld P: [165137]
    Other proteins in same PDB: d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3
    automated match to d1bmfg_
    complexed with anp, mg, po4

Details for d2hldp_

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (P:) ATP synthase gamma chain, mitochondrial

SCOPe Domain Sequences for d2hldp_:

Sequence, based on SEQRES records: (download)

>d2hldp_ c.49.2.0 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgass

Sequence, based on observed residues (ATOM records): (download)

>d2hldp_ c.49.2.0 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetkke
livaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmhpiklsingigkdapt
fqesaliadkllsvmkgtypkisifyndpvssfepsekpifnaktidtdanvprdlfeyt
lanqmltamaqgyaaeisarrnamdnasknagdminrysilynrtrqavitnelvdiitg
ass

SCOPe Domain Coordinates for d2hldp_:

Click to download the PDB-style file with coordinates for d2hldp_.
(The format of our PDB-style files is described here.)

Timeline for d2hldp_: